This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FGFR1 monoclonal antibody (M17), clone 2C1
catalog :
H00002260-M17
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C1
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002260-M17
product name :
FGFR1 monoclonal antibody (M17), clone 2C1
product description :
Mouse monoclonal antibody raised against a partial recombinant FGFR1.
clone name :
2C1
isotype :
IgG2a Kappa
gene name :
FGFR1
gene alias :
BFGFR CD331 CEK FGFBR FLG FLJ99988 FLT2 HBGFR KAL2 N-SAM
gene description :
fibroblast growth factor receptor 1
genbank accession :
NM_000604
immunogen :
FGFR1 (NP_000595.1, 303 a.a. ~ 408 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
DNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTC
LAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEIIIY
CTGAFLISCMVGSVIVYKMKSGTKKSDF
protein accession :
NP_000595.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2007-05-18
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098