This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FGF8 monoclonal antibody (M03), clone 2A12
catalog :
H00002253-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A12
reactivity :
human
product information
catalog id :
H00002253-M03
product name :
FGF8 monoclonal antibody (M03), clone 2A12
product description :
Mouse monoclonal antibody raised against a full length recombinant FGF8.
clone name :
2A12
isotype :
IgG2b Kappa
gene name :
FGF8
gene alias :
AIGF HBGF-8 MGC149376
gene description :
fibroblast growth factor 8 (androgen-induced)
genbank accession :
NM_033164
immunogen :
FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
VRVRGAETGLYICMNKKGK
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAK
LIVETDTFGSR
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAK
LIVETDTFGSR
protein accession :
NP_149354
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2007-10-04
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
