This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FCGR3A monoclonal antibody (M03A), clone 2B11
catalog :
H00002214-M03A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2B11
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002214-M03A
product name :
FCGR3A monoclonal antibody (M03A), clone 2B11
product description :
Mouse monoclonal antibody raised against a full-length recombinant FCGR3A.
clone name :
2B11
isotype :
IgG1 Kappa
gene name :
FCGR3A
gene alias :
CD16 CD16A FCG3 FCGR3 FCGRIII FCR-10 FCRIII FCRIIIA IGFR3
gene description :
Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
genbank accession :
BC017865
immunogen :
FCGR3A (AAH17865.1, 17 a.a. ~ 254 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPED
NSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLS
TLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKN
TALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFC
RGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSF
CLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
PQDK
NSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLS
TLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKN
TALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFC
RGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSF
CLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKD
PQDK
protein accession :
AAH17865.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2008-09-04
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
