This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FCGR1A monoclonal antibody (M01), clone 1D3
catalog :
H00002209-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D3
reactivity :
human
product information
catalog id :
H00002209-M01
product name :
FCGR1A monoclonal antibody (M01), clone 1D3
product description :
Mouse monoclonal antibody raised against a partial recombinant FCGR1A.
clone name :
1D3
isotype :
IgG2a Kappa
gene name :
FCGR1A
gene alias :
CD64 CD64A FCRI FLJ18345 IGFR1
gene description :
Fc fragment of IgG, high affinity Ia, receptor (CD64)
genbank accession :
NM_000566
immunogen :
FCGR1A (NP_000557, 16 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
QVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSST
QWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRS
DPIQLEIHRGWLLLQVSSRVFT
QWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRS
DPIQLEIHRGWLLLQVSSRVFT
protein accession :
NP_000557
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,PLA-Ce
size :
100 ug
autodate :
2008-07-31
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
