product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
FAP monoclonal antibody (M01), clone 1E5
catalog :
H00002191-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1.00E+05
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
more info or order :
citations: 3
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
Wang X, Yao T, Nadvi N, Osborne B, McCaughan G, Gorrell M. Fibroblast activation protein and chronic liver disease. Front Biosci. 2008;13:3168-80 pubmed
|
product information
catalog id :
H00002191-M01
product name :
FAP monoclonal antibody (M01), clone 1E5
product description :
Mouse monoclonal antibody raised against a partial recombinant FAP.
clone name :
1.00E+05
isotype :
IgG2a Kappa
gene name :
FAP
gene alias :
DKFZp686G13158 DPPIV FAPA
gene description :
fibroblast activation protein, alpha
genbank accession :
BC026250
immunogen :
FAP (AAH26250, 525 a.a. ~ 624 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLAS
KEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQIT
AVRKFIEMGFIDEKRIAIWGWS
KEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQIT
AVRKFIEMGFIDEKRIAIWGWS
protein accession :
AAH26250
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IP,S-ELISA,ELISA,WB-Re,WB-Ce
size :
100 ug
autodate :
7/19/07
updatetime :
11/15/13 18:37
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- FAP monoclonal antibody (M02), clone 2F2 | H00002191-M02
- FAP monoclonal antibody (M05), clone 3C7 | H00002191-M05
- FBLN1 MaxPab mouse polyclonal antibody (B01) | H00002192-B01
- FBLN1 purified MaxPab mouse polyclonal antibody (B01P) | H00002192-B01P
- FBLN1 MaxPab rabbit polyclonal antibody (D01) | H00002192-D01
questions and comments
