This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FABP7 DNAxPab
catalog :
H00002173-W01P
quantity :
200 ug
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00002173-W01P
product name :
FABP7 DNAxPab
product description :
Rabbit polyclonal antibody raised against a full-length human FABP7 DNA using DNAx Immune technology.
gene name :
FABP7
gene alias :
B-FABP BLBP DKFZp547J2313 FABPB MRG
gene description :
fatty acid binding protein 7, brain
genbank accession :
NM_001446.3
immunogen :
Full-length human DNA
immunogen sequence protein sequence :
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKP
TVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADD
RNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMT
LTFGDVVAVRHYEKA
TVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADD
RNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMT
LTFGDVVAVRHYEKA
protein accession :
NP_001437.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Flow Cyt-Tr,IF-Ex,IF-Tr,WB-Tr
size :
200 ug
autodate :
2/10/20
updatetime :
2/10/20 15:59
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
