This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ERBB2 monoclonal antibody (M02), clone 2D4
catalog :
H00002064-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2D4
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00002064-M02
product name :
ERBB2 monoclonal antibody (M02), clone 2D4
product description :
Mouse monoclonal antibody raised against a partial recombinant ERBB2.
clone name :
2D4
isotype :
IgG2b Kappa
gene name :
ERBB2
gene alias :
CD340 HER-2 HER-2/neu HER2 NEU NGL TKR1
gene description :
v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
genbank accession :
NM_004448
immunogen :
ERBB2 (NP_004439, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRL
RIVRGTQLFEDNYALAVLDNGD
protein accession :
NP_004439
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
8/22/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098