This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EPO monoclonal antibody (M01), clone 4G7
catalog :
H00002056-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4G7
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002056-M01
product name :
EPO monoclonal antibody (M01), clone 4G7
product description :
Mouse monoclonal antibody raised against a full-length recombinant EPO.
clone name :
4G7
isotype :
IgG2a Kappa
gene name :
EPO
gene alias :
EP MGC138142
gene description :
erythropoietin
genbank accession :
NM_000799.1
immunogen :
EPO (NP_000790.1, 28 a.a. ~ 193 a.a) full-length recombinant protein.
immunogen sequence protein sequence :
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENI
TVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQ
ALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKE
AISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLY
TGEACRTGDR
TVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQ
ALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKE
AISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLY
TGEACRTGDR
protein accession :
NP_000790.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Tr
size :
100 ug
autodate :
2012-06-13
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
