This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EPHB2 monoclonal antibody (M03), clone 4D1
catalog :
H00002048-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D1
reactivity :
human, mouse
application :
western blot, ELISA
product information
catalog id :
H00002048-M03
product name :
EPHB2 monoclonal antibody (M03), clone 4D1
product description :
Mouse monoclonal antibody raised against a partial recombinant EPHB2.
clone name :
4D1
isotype :
IgG2a Kappa
gene name :
EPHB2
gene alias :
CAPB DRT EPHT3 ERK Hek5 MGC87492 PCBC Tyro5
gene description :
EPH receptor B2
genbank accession :
NM_017449
immunogen :
EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVE
NGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNC
VCRNGYYRADLDPLDMPCTTIP
NGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNC
VCRNGYYRADLDPLDMPCTTIP
protein accession :
NP_059145
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse
application key :
S-ELISA,ELISA,WB-Re,WB-Ce
size :
100 ug
autodate :
2/1/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
