ENO3 monoclonal antibody (M01), clone 5D1 | Abnova H00002027-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

ENO3 monoclonal antibody (M01), clone 5D1

catalog :

H00002027-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5D1

reactivity :

human, bovine

application :

western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Abnova product webpage

citations: 7

Published Application/Species/Sample/Dilution	Reference
western blot; bovine; 1:45,000; loading ...; tbl 1	Gagaoua M, Couvreur S, Le Bec G, Aminot G, Picard B. Associations among Protein Biomarkers and pH and Color Traits in Longissimus thoracis and Rectus abdominis Muscles in Protected Designation of Origin Maine-Anjou Cull Cows. J Agric Food Chem. 2017;65:3569-3580 pubmed publisher
western blot; bovine; 1:4000; loading ...; fig 5	Yu Q, Wu W, Tian X, Hou M, Dai R, Li X. Unraveling proteome changes of Holstein beef M. semitendinosus and its relationship to meat discoloration during post-mortem storage analyzed by label-free mass spectrometry. J Proteomics. 2017;154:85-93 pubmed publisher
western blot; human	Picard B, Gagaoua M, Micol D, Cassar Malek I, Hocquette J, Terlouw C. Inverse relationships between biomarkers and beef tenderness according to contractile and metabolic properties of the muscle. J Agric Food Chem. 2014;62:9808-18 pubmed publisher
	Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, et al. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. J Physiol. 2012;590:5211-30 pubmed publisher
	Guillemin N, Bonnet M, Jurie C, Picard B. Functional analysis of beef tenderness. J Proteomics. 2011;75:352-65 pubmed publisher
	Uys G, Ramburan A, Loos B, Kinnear C, Korkie L, Mouton J, et al. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. BMC Cell Biol. 2011;12:18 pubmed publisher
	Chang G, Liu K, Hsieh C, Hu T, Charoenfuprasert S, Liu H, et al. Identification of alpha-enolase as an autoantigen in lung cancer: its overexpression is associated with clinical outcomes. Clin Cancer Res. 2006;12:5746-54 pubmed

product information

catalog id :

H00002027-M01

product name :

ENO3 monoclonal antibody (M01), clone 5D1

product description :

Mouse monoclonal antibody raised against a partial recombinant ENO3.

clone name :

5D1

isotype :

IgG2a Kappa

gene name :

ENO3

gene alias :

MSE

gene description :

enolase 3 (beta, muscle)

genbank accession :

NM_001976

immunogen :

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDD
PARHITGEKLG

protein accession :

NP_001967

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

size :

100 ug

autodate :

2006-10-10

updatetime :

2013-11-15 18:29:55

more info or order :

Abnova product webpage