This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ENO1 monoclonal antibody (M08), clone 5F4
catalog :
H00002023-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5F4
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00002023-M08
product name :
ENO1 monoclonal antibody (M08), clone 5F4
product description :
Mouse monoclonal antibody raised against a full-length recombinant ENO1.
clone name :
5F4
isotype :
IgG1 Kappa
gene name :
ENO1
gene alias :
ENO1L1 MBP-1 MPB1 NNE PPH
gene description :
enolase 1, (alpha)
genbank accession :
BC022545
immunogen :
ENO1 (AAH22545, 1 a.a. ~ 434 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGA
STGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV
SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLA
VCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG
SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNV
IKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKA
GYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISP
DQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG
IQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVT
ESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCT
GQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFR
NPLAK
STGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV
SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLA
VCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG
SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKNV
IKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKA
GYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYISP
DQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG
IQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVT
ESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGLCT
GQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFR
NPLAK
protein accession :
AAH22545
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,ELISA,WB-Re,WB-Ce
size :
100 ug
autodate :
6/4/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
