This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ELAVL4 monoclonal antibody (M01), clone 6B9
catalog :
H00001996-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6B9
reactivity :
human, rat
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00001996-M01
product name :
ELAVL4 monoclonal antibody (M01), clone 6B9
product description :
Mouse monoclonal antibody raised against a partial recombinant ELAVL4.
clone name :
6B9
isotype :
IgG1 Kappa
gene name :
ELAVL4
gene alias :
HUD PNEM
gene description :
ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)
genbank accession :
NM_021952
immunogen :
ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE
AAMAIASLNGYRLGDRVLQVSFKTNKAHKS
AAMAIASLNGYRLGDRVLQVSFKTNKAHKS
protein accession :
NP_068771
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
