This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EIF4G1 monoclonal antibody (M10), clone 2A9
catalog :
H00001981-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A9
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00001981-M10
product name :
EIF4G1 monoclonal antibody (M10), clone 2A9
product description :
Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
clone name :
2A9
isotype :
IgG2b Kappa
gene name :
EIF4G1
gene alias :
DKFZp686A1451 EIF4F EIF4G p220
gene description :
eukaryotic translation initiation factor 4 gamma, 1
genbank accession :
NM_182917
immunogen :
EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQP
PNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGV
ALKSVTAFFKWLREAEEESDHN
PNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGV
ALKSVTAFFKWLREAEEESDHN
protein accession :
NP_886553
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Tr,S-ELISA,ELISA,WB-Re,WB-Ce,IF
size :
100 ug
autodate :
10/12/06
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
