This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EDG3 monoclonal antibody (M02), clone 2G11
catalog :
H00001903-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
immunohistochemistry - paraffin section
product information
catalog id :
H00001903-M02
product name :
EDG3 monoclonal antibody (M02), clone 2G11
product description :
Mouse monoclonal antibody raised against a partial recombinant EDG3.
clone name :
2G11
isotype :
IgG1 Kappa
gene name :
S1PR3
gene alias :
EDG-3 EDG3 FLJ37523 FLJ93220 LPB3 MGC71696 S1P3
gene description :
sphingosine-1-phosphate receptor 3
genbank accession :
NM_005226
immunogen :
EDG3 (NP_005217.2, 302 a.a. ~ 378 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSS
SSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
SSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
protein accession :
NP_005217.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,IHC-P,ELISA
size :
100 ug
autodate :
10/20/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
