product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
DYRK1A monoclonal antibody (M01), clone 7D10
catalog :
H00001859-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
7D10
reactivity :
human, mouse, rat, Human immunodeficiency virus 1
application :
western blot, ELISA, immunoprecipitation
more info or order :
citations: 24
Published Application/Species/Sample/DilutionReference
  • western blot; Human immunodeficiency virus 1; loading ...; fig s1k
Kyei G, Meng S, Ramani R, Niu A, Lagisetti C, Webb T, et al. Splicing Factor 3B Subunit 1 Interacts with HIV Tat and Plays a Role in Viral Transcription and Reactivation from Latency. MBio. 2018;9: pubmed publisher
  • immunoprecipitation; human; fig 4
Glenewinkel F, Cohen M, King C, Kaspar S, Bamberg Lemper S, Mymryk J, et al. The adaptor protein DCAF7 mediates the interaction of the adenovirus E1A oncoprotein with the protein kinases DYRK1A and HIPK2. Sci Rep. 2016;6:28241 pubmed publisher
  • western blot; human; 1:200; fig 1
Booiman T, Loukachov V, van Dort K, van t Wout A, Kootstra N. DYRK1A Controls HIV-1 Replication at a Transcriptional Level in an NFAT Dependent Manner. PLoS ONE. 2015;10:e0144229 pubmed publisher
  • immunoprecipitation; mouse
  • western blot; mouse
Grau C, Arató K, Fernández Fernández J, Valderrama A, Sindreu C, Fillat C, et al. DYRK1A-mediated phosphorylation of GluN2A at Ser(1048) regulates the surface expression and channel activity of GluN1/GluN2A receptors. Front Cell Neurosci. 2014;8:331 pubmed publisher
  • western blot; mouse; 1:250
Janel N, Sarazin M, Corlier F, Corne H, de Souza L, Hamelin L, et al. Plasma DYRK1A as a novel risk factor for Alzheimer's disease. Transl Psychiatry. 2014;4:e425 pubmed publisher
Kisaka J, Ratner L, Kyei G. The Dual-Specificity Kinase DYRK1A Modulates the Levels of Cyclin L2 To Control HIV Replication in Macrophages. J Virol. 2020;94: pubmed publisher
Altafaj X, Martin E, Ortiz Abalia J, Valderrama A, Lao Peregrín C, Dierssen M, et al. Normalization of Dyrk1A expression by AAV2/1-shDyrk1A attenuates hippocampal-dependent defects in the Ts65Dn mouse model of Down syndrome. Neurobiol Dis. 2013;52:117-27 pubmed publisher
Spellman C, Ahmed M, Dubach D, Gardiner K. Expression of trisomic proteins in Down syndrome model systems. Gene. 2013;512:219-25 pubmed publisher
Guo X, Kesimer M, Tolun G, Zheng X, Xu Q, Lu J, et al. The NAD(+)-dependent protein deacetylase activity of SIRT1 is regulated by its oligomeric status. Sci Rep. 2012;2:640 pubmed publisher
Planque C, Dairou J, Noll C, Bui L, Ripoll C, Guedj F, et al. Mice deficient in cystathionine beta synthase display increased Dyrk1A and SAHH activities in brain. J Mol Neurosci. 2013;50:1-6 pubmed publisher
Malinge S, Bliss Moreau M, Kirsammer G, Diebold L, Chlon T, Gurbuxani S, et al. Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome. J Clin Invest. 2012;122:948-62 pubmed publisher
Guedj F, Pereira P, Najas S, Barallobre M, Chabert C, Souchet B, et al. DYRK1A: a master regulatory protein controlling brain growth. Neurobiol Dis. 2012;46:190-203 pubmed publisher
Park J, Sung J, Park J, Song W, Chang S, Chung K. Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP. J Cell Sci. 2012;125:67-80 pubmed publisher
Ahmed M, Sturgeon X, Ellison M, Davisson M, Gardiner K. Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome. J Proteome Res. 2012;11:1251-63 pubmed publisher
Sheppard O, Plattner F, Rubin A, Slender A, Linehan J, Brandner S, et al. Altered regulation of tau phosphorylation in a mouse model of down syndrome aging. Neurobiol Aging. 2012;33:828.e31-44 pubmed publisher
Toiber D, Azkona G, Ben Ari S, Toran N, Soreq H, Dierssen M. Engineering DYRK1A overdosage yields Down syndrome-characteristic cortical splicing aberrations. Neurobiol Dis. 2010;40:348-59 pubmed publisher
Guo X, Williams J, Schug T, Li X. DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. J Biol Chem. 2010;285:13223-32 pubmed publisher
Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar J, Janel N. Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats. Int J Cardiol. 2010;145:306-307 pubmed publisher
Noll C, Planque C, Ripoll C, Guedj F, Diez A, Ducros V, et al. DYRK1A, a novel determinant of the methionine-homocysteine cycle in different mouse models overexpressing this Down-syndrome-associated kinase. PLoS ONE. 2009;4:e7540 pubmed publisher
Lee Y, Ha J, Kim H, Kim Y, Chang E, Song W, et al. Negative feedback Inhibition of NFATc1 by DYRK1A regulates bone homeostasis. J Biol Chem. 2009;284:33343-51 pubmed publisher
Scales T, Lin S, Kraus M, Goold R, Gordon Weeks P. Nonprimed and DYRK1A-primed GSK3 beta-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons. J Cell Sci. 2009;122:2424-35 pubmed publisher
Guedj F, Sebrie C, Rivals I, Ledru A, Paly E, Bizot J, et al. Green tea polyphenols rescue of brain defects induced by overexpression of DYRK1A. PLoS ONE. 2009;4:e4606 pubmed publisher
Hamelet J, Noll C, Ripoll C, Paul J, Janel N, Delabar J. Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice. Biochem Biophys Res Commun. 2009;378:673-7 pubmed publisher
Aranda S, Alvarez M, Turró S, Laguna A, De La Luna S. Sprouty2-mediated inhibition of fibroblast growth factor signaling is modulated by the protein kinase DYRK1A. Mol Cell Biol. 2008;28:5899-911 pubmed publisher
product information
catalog id :
H00001859-M01
product name :
DYRK1A monoclonal antibody (M01), clone 7D10
product description :
Mouse monoclonal antibody raised against a partial recombinant DYRK1A.
clone name :
7D10
isotype :
IgG2b Kappa
gene name :
DYRK1A
gene alias :
DYRK DYRK1 HP86 MNB MNBH
gene description :
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
genbank accession :
NM_001396
immunogen :
DYRK1A (NP_001387, 674 a.a. ~ 763 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQET
GIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMT
GVCVQQSPVASS
protein accession :
NP_001387
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
4/18/08
updatetime :
11/15/13 18:40
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098