This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DNMT1 monoclonal antibody (M01A), clone 2B5
catalog :
H00001786-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2B5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001786-M01A
product name :
DNMT1 monoclonal antibody (M01A), clone 2B5
product description :
Mouse monoclonal antibody raised against a partial recombinant DNMT1.
clone name :
2B5
isotype :
IgG1 Kappa
gene name :
DNMT1
gene alias :
AIM CXXC9 DNMT FLJ16293 MCMT MGC104992
gene description :
DNA (cytosine-5-)-methyltransferase 1
genbank accession :
NM_001379
immunogen :
DNMT1 (NP_001370, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEK
ECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGY
LAKVKSLLNKDLSLENGAHAYNREVNGRLENG
ECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGY
LAKVKSLLNKDLSLENGAHAYNREVNGRLENG
protein accession :
NP_001370
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2009-03-09
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
