This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DLD monoclonal antibody (M02), clone 3C1
catalog :
H00001738-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C1
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
citations: 1
| Reference |
|---|
Chan E, Qian W, Diamond D, Liu T, Gritsenko M, Monroe M, et al. Quantitative analysis of human immunodeficiency virus type 1-infected CD4+ cell proteome: dysregulated cell cycle progression and nuclear transport coincide with robust virus production. J Virol. 2007;81:7571-83 pubmed
|
product information
catalog id :
H00001738-M02
product name :
DLD monoclonal antibody (M02), clone 3C1
product description :
Mouse monoclonal antibody raised against a full length recombinant DLD.
clone name :
3C1
isotype :
IgG3 Kappa
gene name :
DLD
gene alias :
DLDH E3 GCSL LAD PHE3
gene description :
dihydrolipoamide dehydrogenase
genbank accession :
BC018696
immunogen :
DLD (AAH18696, 1 a.a. ~ 509 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQP
IDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGG
TCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVR
LNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI
TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQR
LGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFK
LNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVC
IGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIY
AIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVP
SVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRA
KTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAA
LALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSI
NF
IDADVTVIGSGPGGYVAAIKAAQLGFKTVCIEKNETLGG
TCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVR
LNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKI
TGKNQVTATKADGGTQVIDTKNILIATGSEVTPFPGITI
DEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQR
LGADVTAVEFLGHVGGVGIDMEISKNFQRILQKQGFKFK
LNTKVTGATKKSDGKIDVSIEAASGGKAEVITCDVLLVC
IGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIY
AIGDVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVP
SVIYTHPEVAWVGKSEEQLKEEGIEYKVGKFPFAANSRA
KTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAA
LALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSI
NF
protein accession :
AAH18696
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Ce,IHC-P
size :
100 ug
autodate :
11/2/06
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
