This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DEFA3 monoclonal antibody (M01), clone 1A9
catalog :
H00001668-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1A9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001668-M01
product name :
DEFA3 monoclonal antibody (M01), clone 1A9
product description :
Mouse monoclonal antibody raised against a full-length recombinant DEFA3.
clone name :
1A9
isotype :
IgG2a Kappa
gene name :
DEFA3
gene alias :
DEF3 HNP-3 HNP3 HP-3
gene description :
defensin, alpha 3, neutrophil-specific
genbank accession :
NM_005217.2
immunogen :
DEFA3 (NP_005208.1, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAAD
IPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGER
RYGTCIYQGRLWAFCC
IPEVVVSLAWDESLAPKHPGSRKNMDCYCRIPACIAGER
RYGTCIYQGRLWAFCC
protein accession :
NP_005208.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2014-03-13
updatetime :
2014-03-13 11:01:49
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
