This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DHX9 monoclonal antibody (M03), clone 1D10
catalog :
H00001660-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001660-M03
product name :
DHX9 monoclonal antibody (M03), clone 1D10
product description :
Mouse monoclonal antibody raised against a partial recombinant DHX9.
clone name :
1D10
isotype :
IgG1 Kappa
gene name :
DHX9
gene alias :
DDX9 LKP NDHII RHA
gene description :
DEAH (Asp-Glu-Ala-His) box polypeptide 9
genbank accession :
NM_001357
immunogen :
DHX9 (NP_001348, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQ
VEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSE
EVPAFGVASPPP
VEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSE
EVPAFGVASPPP
protein accession :
NP_001348
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
11/30/09
updatetime :
11/15/13 18:46
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
