This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
DDB2 monoclonal antibody (M01), clone 1F11
catalog :
H00001643-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F11
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001643-M01
product name :
DDB2 monoclonal antibody (M01), clone 1F11
product description :
Mouse monoclonal antibody raised against a partial recombinant DDB2.
clone name :
1F11
isotype :
IgG2b Kappa
gene name :
DDB2
gene alias :
DDBB FLJ34321 UV-DDB2
gene description :
damage-specific DNA binding protein 2, 48kDa
genbank accession :
BC000093
immunogen :
DDB2 (AAH00093, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCA
KGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKL
GRASWPSVQQGLQQSFLHTLDSYRILQKAAP
KGSGPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKL
GRASWPSVQQGLQQSFLHTLDSYRILQKAAP
protein accession :
AAH00093
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
7/20/09
updatetime :
11/15/13 18:43
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
