This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CYP24A1 monoclonal antibody (M02), clone 1E1
catalog :
H00001591-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1E1
reactivity :
human
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00001591-M02
product name :
CYP24A1 monoclonal antibody (M02), clone 1E1
product description :
Mouse monoclonal antibody raised against a partial recombinant CYP24A1.
clone name :
1E1
isotype :
IgG2a Kappa
gene name :
CYP24A1
gene alias :
CP24 CYP24 MGC126273 MGC126274 P450-CC24
gene description :
cytochrome P450, family 24, subfamily A, polypeptide 1
genbank accession :
NM_000782
immunogen :
CYP24A1 (NP_000773, 415 a.a. ~ 514 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHL
PFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEP
VEMLHSGTLVPSRELPIAFCQR
PFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDNEP
VEMLHSGTLVPSRELPIAFCQR
protein accession :
NP_000773
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2008-05-02
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
