This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CYP1A2 monoclonal antibody (M10), clone 3D2
catalog :
H00001544-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3D2
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00001544-M10
product name :
CYP1A2 monoclonal antibody (M10), clone 3D2
product description :
Mouse monoclonal antibody raised against a partial recombinant CYP1A2.
clone name :
3D2
isotype :
IgG3 Kappa
gene name :
CYP1A2
gene alias :
CP12 P3-450 P450(PA)
gene description :
cytochrome P450, family 1, subfamily A, polypeptide 2
genbank accession :
NM_000761
immunogen :
CYP1A2 (NP_000752, 211 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ESSDEMLSLVKNTHEFVETASSGNPLDFFPILRYLPNPA
LQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALF
KHSKKGPRASGNLIPQEKIVNL
LQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALF
KHSKKGPRASGNLIPQEKIVNL
protein accession :
NP_000752
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2011-11-03
updatetime :
2013-11-15 18:48:17
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
