product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
CUTL1 monoclonal antibody (M01), clone 2A10
catalog :
H00001523-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A10
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 3
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
| Nguyen H, Kadam P, Helkin A, Cao K, Wu S, Samara G, et al. MT1-MMP Activation of TGF-? Signaling Enables Intercellular Activation of an Epithelial-mesenchymal Transition Program in Cancer. Curr Cancer Drug Targets. 2016;16:618-30 pubmed
|
product information
catalog id :
H00001523-M01
product name :
CUTL1 monoclonal antibody (M01), clone 2A10
product description :
Mouse monoclonal antibody raised against a partial recombinant CUTL1.
clone name :
2A10
isotype :
IgG1 kappa
gene name :
CUX1
gene alias :
CASP CDP CDP/Cut CDP1 COY1 CUTL1 CUX Clox Cux/CDP GOLIM6 Nbla10317 p100 p110 p200 p75
gene description :
cut-like homeobox 1
genbank accession :
NM_001913
immunogen :
CUTL1 (NP_001904.2, 521 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
AENRLAQHTLQALQSELDSLRADNIKLFEKIKFLQSYPG
RGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLS
PWDKATLSMGRLVLSNKMARTI
RGSGSDDTELRYSSQYEERLDPFSSFSKRERQRKYLSLS
PWDKATLSMGRLVLSNKMARTI
protein accession :
NP_001904.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IP,S-ELISA,IF,ELISA,WB-Re,IHC-P
size :
100 ug
autodate :
4/18/08
updatetime :
11/15/13 18:40
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- CUTL1 monoclonal antibody (M02), clone 2D10 | H00001523-M02
- CX3CR1 purified MaxPab mouse polyclonal antibody (B01P) | H00001524-B01P
- CX3CR1 monoclonal antibody (M01), clone 2B11 | H00001524-M01
- CX3CR1 monoclonal antibody (M07), clone 10D5 | H00001524-M07
- CXADR purified MaxPab rabbit polyclonal antibody (D01P) | H00001525-D01P
questions and comments
