This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CTSK monoclonal antibody (M01), clone 2F1
catalog :
H00001513-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F1
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00001513-M01
product name :
CTSK monoclonal antibody (M01), clone 2F1
product description :
Mouse monoclonal antibody raised against a partial recombinant CTSK.
clone name :
2F1
isotype :
IgG2a Kappa
gene name :
CTSK
gene alias :
CTS02 CTSO CTSO1 CTSO2 MGC23107 PKND PYCD
gene description :
cathepsin K
genbank accession :
BC016058
immunogen :
CTSK (AAH16058, 220 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQF
YSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS
WGENWGNKGYILMARNKNNACGIANLASFPKM
YSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNS
WGENWGNKGYILMARNKNNACGIANLASFPKM
protein accession :
AAH16058
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,IHC-P,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
