CTH monoclonal antibody (M01), clone 4E1-1B7 | Abnova H00001491-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

CTH monoclonal antibody (M01), clone 4E1-1B7

catalog :

H00001491-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4E1-1B7

reactivity :

human, mouse

application :

western blot, ELISA

more info or order :

Abnova product webpage

citations: 17

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; fig 5	Li J, Li Q, Du H, Wang Y, You S, Wang F, et al. Homocysteine Triggers Inflammatory Responses in Macrophages through Inhibiting CSE-H2S Signaling via DNA Hypermethylation of CSE Promoter. Int J Mol Sci. 2015;16:12560-77 pubmed publisher
western blot; mouse	Xu Y, Du H, Li J, Xu R, Wang Y, You S, et al. Statins upregulate cystathionine ?-lyase transcription and H2S generation via activating Akt signaling in macrophage. Pharmacol Res. 2014;87:18-25 pubmed publisher
	Fu M, Zhang W, Yang G, Wang R. Is cystathionine gamma-lyase protein expressed in the heart?. Biochem Biophys Res Commun. 2012;428:469-74 pubmed publisher
	Dufton N, Natividad J, Verdu E, Wallace J. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Sci Rep. 2012;2:499 pubmed publisher
	Yang G, Li H, Tang G, Wu L, Zhao K, Cao Q, et al. Increased neointimal formation in cystathionine gamma-lyase deficient mice: role of hydrogen sulfide in ?5?1-integrin and matrix metalloproteinase-2 expression in smooth muscle cells. J Mol Cell Cardiol. 2012;52:677-88 pubmed publisher
	Li X, Mao X, Hei R, Zhang Z, Wen L, Zhang P, et al. Protective role of hydrogen sulfide against noise-induced cochlear damage: a chronic intracochlear infusion model. PLoS ONE. 2011;6:e26728 pubmed publisher
	Yang G, Pei Y, Cao Q, Wang R. MicroRNA-21 represses human cystathionine gamma-lyase expression by targeting at specificity protein-1 in smooth muscle cells. J Cell Physiol. 2012;227:3192-200 pubmed publisher
	Yang G, Pei Y, Teng H, Cao Q, Wang R. Specificity protein-1 as a critical regulator of human cystathionine gamma-lyase in smooth muscle cells. J Biol Chem. 2011;286:26450-60 pubmed publisher
	Kasparek M, Linden D, Farrugia G, Sarr M. Hydrogen sulfide modulates contractile function in rat jejunum. J Surg Res. 2012;175:234-42 pubmed publisher
	Fang L, Zhao J, Chen Y, Ma T, Xu G, Tang C, et al. Hydrogen sulfide derived from periadventitial adipose tissue is a vasodilator. J Hypertens. 2009;27:2174-85 pubmed publisher
	Martin G, McKnight G, Dicay M, Coffin C, Ferraz J, Wallace J. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Dig Liver Dis. 2010;42:103-9 pubmed publisher
	Wallace J, Vong L, McKnight W, Dicay M, Martin G. Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats. Gastroenterology. 2009;137:569-78, 578.e1 pubmed publisher
	Tripatara P, Patel N, Brancaleone V, Renshaw D, Rocha J, Sepodes B, et al. Characterisation of cystathionine gamma-lyase/hydrogen sulphide pathway in ischaemia/reperfusion injury of the mouse kidney: an in vivo study. Eur J Pharmacol. 2009;606:205-9 pubmed publisher
	Feng X, Chen Y, Zhao J, Tang C, Jiang Z, Geng B. Hydrogen sulfide from adipose tissue is a novel insulin resistance regulator. Biochem Biophys Res Commun. 2009;380:153-9 pubmed publisher
	Fu Z, Liu X, Geng B, Fang L, Tang C. Hydrogen sulfide protects rat lung from ischemia-reperfusion injury. Life Sci. 2008;82:1196-202 pubmed publisher
	Wallace J, Dicay M, McKnight W, Martin G. Hydrogen sulfide enhances ulcer healing in rats. FASEB J. 2007;21:4070-6 pubmed
	Schicho R, Krueger D, Zeller F, Von Weyhern C, Frieling T, Kimura H, et al. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Gastroenterology. 2006;131:1542-52 pubmed

product information

catalog id :

H00001491-M01

product name :

CTH monoclonal antibody (M01), clone 4E1-1B7

product description :

Mouse monoclonal antibody raised against a full length recombinant CTH.

clone name :

4E1-1B7

isotype :

IgG1 Kappa

gene name :

CTH

gene alias :

MGC9471

gene description :

cystathionase (cystathionine gamma-lyase)

genbank accession :

BC015807

immunogen :

CTH (AAH15807, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVP
PISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAAL
DGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGT
NRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWI
ETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYF
QRPLALGADISMYSATKYMNGRSDVVMGLVSVNCESLHN
RLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNG
MAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTG
MVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELP
AIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDL
DQALKAAHPPSGSHS

protein accession :

AAH15807

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Guinea pig,Human

application key :

WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr

size :

100 ug

autodate :

2008-04-30

updatetime :

2013-11-15 18:40:03

more info or order :

Abnova product webpage