This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CTGF monoclonal antibody (M08), clone 4D9
catalog :
H00001490-M08
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D9
reactivity :
human
product information
catalog id :
H00001490-M08
product name :
CTGF monoclonal antibody (M08), clone 4D9
product description :
Mouse monoclonal antibody raised against a full-length recombinant CTGF.
clone name :
4D9
isotype :
IgG2b Kappa
gene name :
CTGF
gene alias :
CCN2 HCS24 IGFBP8 MGC102839 NOV2
gene description :
connective tissue growth factor
genbank accession :
NM_001901
immunogen :
CTGF (NP_001892.1, 31 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCT
ERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGT
VYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPD
CPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLED
TFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDN
ASCRLEKQSRLCMVRPCEADLEENIK
ERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGT
VYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPD
CPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLED
TFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDN
ASCRLEKQSRLCMVRPCEADLEENIK
protein accession :
NP_001892.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2008-05-23
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
