This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CSF3 monoclonal antibody (M03), clone 2C5
catalog :
H00001440-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C5
reactivity :
human
application :
immunoprecipitation
product information
catalog id :
H00001440-M03
product name :
CSF3 monoclonal antibody (M03), clone 2C5
product description :
Mouse monoclonal antibody raised against a full length recombinant CSF3.
clone name :
2C5
isotype :
IgG2a Kappa
gene name :
CSF3
gene alias :
G-CSF GCSF MGC45931
gene description :
colony stimulating factor 3 (granulocyte)
immunogen :
CSF3 (NP_757373, 31 a.a. ~ 207 a.a) recombinant protein.
immunogen sequence protein sequence :
MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCAT
YKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQ
LHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATT
IWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVAS
HLQSFLEVSYRVLRHLAQP
YKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQ
LHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATT
IWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVAS
HLQSFLEVSYRVLRHLAQP
protein accession :
-
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,IP
size :
100 ug
autodate :
2007-01-18
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
