CRX monoclonal antibody (M02), clone 4G11 | Abnova H00001406-M02 product information

product summary

company name :

Abnova

product type :

antibody

product name :

CRX monoclonal antibody (M02), clone 4G11

catalog :

H00001406-M02

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4G11

reactivity :

human, mouse

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - frozen section

more info or order :

Abnova product webpage

citations: 13

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:800; fig 2f	Cuevas E, Holder D, Alshehri A, Tr xe9 guier J, Lakowski J, Sowden J. NRL-/- gene edited human embryonic stem cells generate rod-deficient retinal organoids enriched in S-cone-like photoreceptors. Stem Cells. 2021;39:414-428 pubmed publisher
immunohistochemistry - frozen section; mouse; 1:2000; loading ...; fig 1s1j	Vigouroux R, Cesar Q, Chedotal A, Nguyen Ba Charvet K. Revisiting the role of Dcc in visual system development with a novel eye clearing method. elife. 2020;9: pubmed publisher
immunohistochemistry - frozen section; human; 1:5000; loading ...; fig s1a	Garita Hernandez M, Routet F, Guibbal L, Khabou H, Toualbi L, Riancho L, et al. AAV-Mediated Gene Delivery to 3D Retinal Organoids Derived from Human Induced Pluripotent Stem Cells. Int J Mol Sci. 2020;21: pubmed publisher
immunocytochemistry; human; 1:500; fig 2f	Khan M, Walters L, Li Q, Thomas D, Miller J, Zhang Q, et al. Characterization and pharmacologic targeting of EZH2, a fetal retinal protein and epigenetic regulator, in human retinoblastoma. Lab Invest. 2015;95:1278-90 pubmed publisher
immunocytochemistry; human; 1:100	Ohlemacher S, Iglesias C, Sridhar A, Gamm D, Meyer J. Generation of highly enriched populations of optic vesicle-like retinal cells from human pluripotent stem cells. Curr Protoc Stem Cell Biol. 2015;32:1H.8.1-20 pubmed publisher
western blot; mouse	Peng G, Chen S. Crx activates opsin transcription by recruiting HAT-containing co-activators and promoting histone acetylation. Hum Mol Genet. 2007;16:2433-52 pubmed
	Garita Hernandez M, Lampič M, Chaffiol A, Guibbal L, Routet F, Santos Ferreira T, et al. Restoration of visual function by transplantation of optogenetically engineered photoreceptors. Nat Commun. 2019;10:4524 pubmed publisher
	Izuogu O, Alhasan A, Mellough C, Collin J, Gallon R, Hyslop J, et al. Analysis of human ES cell differentiation establishes that the dominant isoforms of the lncRNAs RMST and FIRRE are circular. BMC Genomics. 2018;19:276 pubmed publisher
	Elsaeidi F, MacPherson P, Mills E, Jui J, Flannery J, Goldman D. Notch Suppression Collaborates with Ascl1 and Lin28 to Unleash a Regenerative Response in Fish Retina, But Not in Mice. J Neurosci. 2018;38:2246-2261 pubmed publisher
	Jayaram H, Jones M, Eastlake K, Cottrill P, Becker S, Wiseman J, et al. Transplantation of photoreceptors derived from human Muller glia restore rod function in the P23H rat. Stem Cells Transl Med. 2014;3:323-33 pubmed publisher
	Carr A, Vugler A, Yu L, Semo M, Coffey P, Moss S, et al. The expression of retinal cell markers in human retinal pigment epithelial cells and their augmentation by the synthetic retinoid fenretinide. Mol Vis. 2011;17:1701-15 pubmed
	Sakagami K, Gan L, Yang X. Distinct effects of Hedgehog signaling on neuronal fate specification and cell cycle progression in the embryonic mouse retina. J Neurosci. 2009;29:6932-44 pubmed publisher
	Esumi N, Kachi S, Hackler L, Masuda T, Yang Z, Campochiaro P, et al. BEST1 expression in the retinal pigment epithelium is modulated by OTX family members. Hum Mol Genet. 2009;18:128-41 pubmed publisher

product information

catalog id :

H00001406-M02

product name :

CRX monoclonal antibody (M02), clone 4G11

product description :

Mouse monoclonal antibody raised against a partial recombinant CRX.

clone name :

4G11

isotype :

IgG2a Kappa

gene name :

CRX

gene alias :

CORD2 CRD LCA7 OTX3

gene description :

cone-rod homeobox

genbank accession :

NM_000554

immunogen :

CRX (NP_000545, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

MMAYMNPGPHYSVNALALSGPSVDLMHQAVPYPSAPRKQ
RRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINL
PESRVQVWFKNRRAKCR

protein accession :

NP_000545

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

S-ELISA,ELISA,WB-Re,WB-Tr,WB-Ce

size :

100 ug

autodate :

10/10/06

updatetime :

11/15/13 18:29

more info or order :

Abnova product webpage