This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ATF2 monoclonal antibody (M33), clone 1C2
catalog :
H00001386-M33
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C2
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00001386-M33
product name :
ATF2 monoclonal antibody (M33), clone 1C2
product description :
Mouse monoclonal antibody raised against a partial recombinant ATF2.
clone name :
1C2
isotype :
IgG2a Kappa
gene name :
ATF2
gene alias :
CRE-BP1 CREB2 HB16 MGC111558 TREB7
gene description :
activating transcription factor 2
genbank accession :
NM_001880
immunogen :
ATF2 (NP_001871.2, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVV
ETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPAS
LQVPNVLLTSSDSSVIIQQAVP
ETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPAS
LQVPNVLLTSSDSSVIIQQAVP
protein accession :
NP_001871.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,ELISA,WB-Re,PLA-Ce
size :
100 ug
autodate :
2008-06-09
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
