This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ATF2 monoclonal antibody (M01A), clone 4C12
catalog :
H00001386-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4C12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001386-M01A
product name :
ATF2 monoclonal antibody (M01A), clone 4C12
product description :
Mouse monoclonal antibody raised against a full-length recombinant ATF2.
clone name :
4C12
isotype :
IgG3 Kappa
gene name :
ATF2
gene alias :
CRE-BP1 CREB2 HB16 MGC111558 TREB7
gene description :
activating transcription factor 2
genbank accession :
BC026175
immunogen :
ATF2 (AAH26175, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNE
DHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATP
IIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQT
AQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSS
TVITQAPSSNRPIV
DHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATP
IIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQT
AQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSS
TVITQAPSSNRPIV
protein accession :
AAH26175
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2009-04-27
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
