This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CNTF MaxPab mouse polyclonal antibody (B01)
catalog :
H00001270-B01
quantity :
50 uL
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00001270-B01
product name :
CNTF MaxPab mouse polyclonal antibody (B01)
product description :
Mouse polyclonal antibody raised against a full-length human CNTF protein.
gene name :
CNTF
gene alias :
HCNTF
gene description :
ciliary neurotrophic factor
genbank accession :
NM_000614
immunogen :
CNTF (NP_000605, 1 a.a. ~ 200 a.a) full-length human protein.
immunogen sequence protein sequence :
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYV
KHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQ
AYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVA
AFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKL
WGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIA
NNKKM
KHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQ
AYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVA
AFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKL
WGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIA
NNKKM
protein accession :
NP_000605
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
note :
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr
size :
50 uL
autodate :
2008-01-18
updatetime :
2011-01-13 12:01:47
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
