This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CCBP2 purified MaxPab mouse polyclonal antibody (B01P)
catalog :
H00001238-B01P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00001238-B01P
product name :
CCBP2 purified MaxPab mouse polyclonal antibody (B01P)
product description :
Mouse polyclonal antibody raised against a full-length human CCBP2 protein.
gene name :
CCBP2
gene alias :
CCR10 CCR9 CMKBR9 D6 MGC126678 MGC138250 hD6
gene description :
chemokine binding protein 2
genbank accession :
BC008816
immunogen :
CCBP2 (AAH08816, 1 a.a. ~ 384 a.a) full-length human protein.
immunogen sequence protein sequence :
MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCRKD
AVVSFGKVFLPVFYSLIFVLGLSGNLLLLMVLLRYVPRR
RMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLC
KMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLR
TRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNC
HADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIG
CVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLH
TLLDLQVFGNCEVSQHLDYALQVTESIAFLHCCFSPILY
AFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESS
ILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
AVVSFGKVFLPVFYSLIFVLGLSGNLLLLMVLLRYVPRR
RMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGSFLC
KMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQPYHRLR
TRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKGVWNC
HADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFFYSRIG
CVLVRLRPAGQGRALKIAAALVVAFFVLWFPYNLTLFLH
TLLDLQVFGNCEVSQHLDYALQVTESIAFLHCCFSPILY
AFSSHRFRQYLKAFLAAVLGWHLAPGTAQASLSSCSESS
ILTAQEEMTGMNDLGERQSENYPNKEDVGNKSA
protein accession :
AAH08816
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,WB-Tr
size :
50 ug
autodate :
2008-09-29
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
