This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CKM monoclonal antibody (M01A), clone 3E1-F3
catalog :
H00001158-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E1-F3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001158-M01A
product name :
CKM monoclonal antibody (M01A), clone 3E1-F3
product description :
Mouse monoclonal antibody raised against a full-length recombinant CKM.
clone name :
3E1-F3
isotype :
IgG1 Kappa
gene name :
CKM
gene alias :
CKMM M-CK
gene description :
creatine kinase, muscle
genbank accession :
BC007462
immunogen :
CKM (AAH07462, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELY
KKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGD
EESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKG
GDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEK
LSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFD
KPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDH
LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMW
NQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEIL
TRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQ
LVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
KKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGD
EESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKG
GDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEK
LSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFD
KPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDH
LRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMW
NQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEIL
TRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQ
LVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
protein accession :
AAH07462
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2008-10-27
updatetime :
2012-01-13 16:42:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
