This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
AKR1C4 monoclonal antibody (M01), clone 2C11
catalog :
H00001109-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C11
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
citations: 2
| Reference |
|---|
Stayrook K, Rogers P, Savkur R, Wang Y, Su C, Varga G, et al. Regulation of human 3 alpha-hydroxysteroid dehydrogenase (AKR1C4) expression by the liver X receptor alpha. Mol Pharmacol. 2008;73:607-12 pubmed
|
product information
catalog id :
H00001109-M01
product name :
AKR1C4 monoclonal antibody (M01), clone 2C11
product description :
Mouse monoclonal antibody raised against a full length recombinant AKR1C4.
clone name :
2C11
isotype :
IgG1 kappa
gene name :
AKR1C4
gene alias :
3-alpha-HSD C11 CDR CHDR DD4 HAKRA MGC22581
gene description :
aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4)
genbank accession :
BC020744
immunogen :
AKR1C4 (AAH20744, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTK
LAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKRED
IFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLH
FPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKD
AGLAKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHP
YLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPV
LLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYN
EQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLM
DHPDYPFSDEY
LAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKRED
IFYTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLH
FPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKD
AGLAKSIGVSNFNYRQLEMILNKPGLKYKPVCNQVECHP
YLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPV
LLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYN
EQRIRENIQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLM
DHPDYPFSDEY
protein accession :
AAH20744
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
