This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CFL1 monoclonal antibody (M04), clone 1A1
catalog :
H00001072-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1A1
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
citations: 2
| Reference |
|---|
Franciosi L, Govorukhina N, Fusetti F, Poolman B, Lodewijk M, Timens W, et al. Proteomic analysis of human epithelial lining fluid by microfluidics-based nanoLC-MS/MS: a feasibility study. Electrophoresis. 2013;34:2683-94 pubmed
|
product information
catalog id :
H00001072-M04
product name :
CFL1 monoclonal antibody (M04), clone 1A1
product description :
Mouse monoclonal antibody raised against a full length recombinant CFL1.
clone name :
1A1
isotype :
IgG2a Kappa
gene name :
CFL1
gene alias :
CFL
gene description :
cofilin 1 (non-muscle)
genbank accession :
BC011005
immunogen :
CFL1 (AAH11005, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFC
LSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDK
DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIY
ASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGS
AVISLEGKPL
LSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDK
DCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIY
ASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGS
AVISLEGKPL
protein accession :
AAH11005
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
S-ELISA,ELISA,WB-Re,IHC-P,WB-Ce,IF
size :
100 ug
autodate :
11/29/06
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
