product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
CETN3 monoclonal antibody (M01), clone 3E6
catalog :
H00001070-M01
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3.00E+06
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunohistochemistry, immunocytochemistry, flow cytometry
more info or order :
citations: 15
Published Application/Species/Sample/DilutionReference
  • immunocytochemistry; human; 1:100; loading ...
Baudoin N, Nicholson J, Soto K, Martin O, Chen J, Cimini D. Asymmetric clustering of centrosomes defines the early evolution of tetraploid cells. elife. 2020;9: pubmed publisher
  • immunocytochemistry; human; 1:100; loading ...; fig 1a, 4g
Huang N, Zhang D, Li F, Chai P, Wang S, Teng J, et al. M-Phase Phosphoprotein 9 regulates ciliogenesis by modulating CP110-CEP97 complex localization at the mother centriole. Nat Commun. 2018;9:4511 pubmed publisher
  • immunohistochemistry; rat; 1:250; fig s7
Doobin D, Kemal S, Dantas T, Vallee R. Severe NDE1-mediated microcephaly results from neural progenitor cell cycle arrests at multiple specific stages. Nat Commun. 2016;7:12551 pubmed publisher
  • immunocytochemistry; human; 1:1000; fig 3
Chang C, Hsu W, Tsai J, Tang C, Tang T. CEP295 interacts with microtubules and is required for centriole elongation. J Cell Sci. 2016;129:2501-13 pubmed publisher
  • western blot; human; 1:500; fig 6
Chavali P, Chandrasekaran G, Barr A, Tátrai P, Taylor C, Papachristou E, et al. A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer. Nat Commun. 2016;7:11005 pubmed publisher
  • immunocytochemistry; mouse; fig 4
Lee Y, Santé J, Comerci C, Cyge B, Menezes L, Li F, et al. Cby1 promotes Ahi1 recruitment to a ring-shaped domain at the centriole-cilium interface and facilitates proper cilium formation and function. Mol Biol Cell. 2014;25:2919-33 pubmed publisher
  • immunocytochemistry; human
Mäki Jouppila J, Laine L, Rehnberg J, Narvi E, Tiikkainen P, Hukasova E, et al. Centmitor-1, a novel acridinyl-acetohydrazide, possesses similar molecular interaction field and antimitotic cellular phenotype as rigosertib, on 01910.Na. Mol Cancer Ther. 2014;13:1054-66 pubmed publisher
Pruikkonen S, Kallio M. Excess of a Rassf1-targeting microRNA, miR-193a-3p, perturbs cell division fidelity. Br J Cancer. 2017;116:1451-1461 pubmed publisher
Prosser S, Morrison C. Centrin2 regulates CP110 removal in primary cilium formation. J Cell Biol. 2015;208:693-701 pubmed publisher
Dantas T, Daly O, Conroy P, Tomas M, Wang Y, Lalor P, et al. Calcium-binding capacity of centrin2 is required for linear POC5 assembly but not for nucleotide excision repair. PLoS ONE. 2013;8:e68487 pubmed publisher
Loffler H, Fechter A, Liu F, Poppelreuther S, Kramer A. DNA damage-induced centrosome amplification occurs via excessive formation of centriolar satellites. Oncogene. 2013;32:2963-72 pubmed publisher
Sir J, Barr A, Nicholas A, Carvalho O, Khurshid M, Sossick A, et al. A primary microcephaly protein complex forms a ring around parental centrioles. Nat Genet. 2011;43:1147-53 pubmed publisher
Dantas T, Wang Y, Lalor P, Dockery P, Morrison C. Defective nucleotide excision repair with normal centrosome structures and functions in the absence of all vertebrate centrins. J Cell Biol. 2011;193:307-18 pubmed publisher
Fabian Z, Fearnhead H. TPCK targets elements of mitotic spindle and induces cell cycle arrest in prometaphase. Biochem Biophys Res Commun. 2010;395:458-64 pubmed publisher
Barr A, Kilmartin J, Gergely F. CDK5RAP2 functions in centrosome to spindle pole attachment and DNA damage response. J Cell Biol. 2010;189:23-39 pubmed publisher
product information
catalog id :
H00001070-M01
product name :
CETN3 monoclonal antibody (M01), clone 3E6
product description :
Mouse monoclonal antibody raised against a partial recombinant CETN3.
clone name :
3.00E+06
isotype :
IgG2b Kappa
gene name :
CETN3
gene alias :
CEN3 MGC12502 MGC138245
gene description :
centrin, EF-hand protein, 3 (CDC31 homolog, yeast)
genbank accession :
BC005383
immunogen :
CETN3 (AAH05383, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDT
DKDEAIDYHELKVAMRALGFDVKKADVLKILKDYDREAT
GKITFEDFNEVVTDWILERDPH
protein accession :
AAH05383
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,S-ELISA,RNAi-Ab,ELISA,WB-Re,WB-Ce
size :
50 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098