This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CDK5 monoclonal antibody (M01A), clone 1A2
catalog :
H00001020-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1A2
reactivity :
human
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00001020-M01A
product name :
CDK5 monoclonal antibody (M01A), clone 1A2
product description :
Mouse monoclonal antibody raised against a partial recombinant CDK5.
clone name :
1A2
isotype :
IgM Kappa
gene name :
CDK5
gene alias :
PSSALRE
gene description :
cyclin-dependent kinase 5
genbank accession :
BC005115
immunogen :
CDK5 (AAH05115, 195 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKL
PDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV
QRISAEEALQHPYFSDFCPP
PDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV
QRISAEEALQHPYFSDFCPP
protein accession :
AAH05115
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,ELISA,WB-Re,WB-Ti
size :
200 uL
autodate :
8/25/08
updatetime :
1/5/12 19:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
