This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CDH17 monoclonal antibody (M01), clone 1H3
catalog :
H00001015-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1H3
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
citations: 2
| Reference |
|---|
Park J, Seol J, Choi H, Roh Y, Choi P, Lee K, et al. Comparison of cadherin-17 expression between primary colorectal adenocarcinomas and their corresponding metastases: the possibility of a diagnostic marker for detecting the primary site of metastatic tumour. Histopathology. 2011;58:315-8 pubmed publisher
|
product information
catalog id :
H00001015-M01
product name :
CDH17 monoclonal antibody (M01), clone 1H3
product description :
Mouse monoclonal antibody raised against a partial recombinant CDH17.
clone name :
1H3
isotype :
IgG1 Kappa
gene name :
CDH17
gene alias :
CDH16 FLJ26931 HPT-1 HPT1 MGC138218 MGC142024
gene description :
cadherin 17, LI cadherin (liver-intestine)
genbank accession :
NM_004063
immunogen :
CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFEL
TGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDA
NGIIVEGPVPITIEVKDINDNRPTFLQSKY
TGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDA
NGIIVEGPVPITIEVKDINDNRPTFLQSKY
protein accession :
NP_004054
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IHC-P,WB-Ti
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
