This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CDH2 monoclonal antibody (M02), clone 4B11
catalog :
H00001000-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4B11
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00001000-M02
product name :
CDH2 monoclonal antibody (M02), clone 4B11
product description :
Mouse monoclonal antibody raised against a partial recombinant CDH2.
clone name :
4B11
isotype :
IgG2a Kappa
gene name :
CDH2
gene alias :
CD325 CDHN CDw325 NCAD
gene description :
cadherin 2, type 1, N-cadherin (neuronal)
genbank accession :
NM_001792
immunogen :
CDH2 (NP_001783, 807 a.a. ~ 906 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
RRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADN
DPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDY
DYLNDWGPRFKKLADMYGGGDD
DPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDY
DYLNDWGPRFKKLADMYGGGDD
protein accession :
NP_001783
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2011-06-08
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
