This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD40 monoclonal antibody (M02), clone 1C10
catalog :
H00000958-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C10
reactivity :
human
product information
catalog id :
H00000958-M02
product name :
CD40 monoclonal antibody (M02), clone 1C10
product description :
Mouse monoclonal antibody raised against a partial recombinant CD40.
clone name :
1C10
isotype :
IgG1 Kappa
gene name :
CD40
gene alias :
Bp50 CDW40 MGC9013 TNFRSF5 p50
gene description :
CD40 molecule, TNF receptor superfamily member 5
genbank accession :
BC012419
immunogen :
CD40 (AAH12419, 21 a.a. ~ 193 a.a) partial recombinant protein.
immunogen sequence protein sequence :
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETEC
LPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSE
TDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATG
VSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQ
AGTNKTDVVCGPQDRLR
LPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSE
TDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATG
VSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQ
AGTNKTDVVCGPQDRLR
protein accession :
AAH12419
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
4/5/12
updatetime :
9/5/17 15:48
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
