This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD40 monoclonal antibody (K03), clone 3A6
catalog :
H00000958-K03
quantity :
50 ug
clonality :
monoclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
3A6
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00000958-K03
product name :
CD40 monoclonal antibody (K03), clone 3A6
product description :
Rabbit monoclonal antibody raised against a partial recombinant CD40.
clone name :
3A6
gene name :
CD40
gene alias :
Bp50 CDW40 MGC9013 TNFRSF5 p50
gene description :
CD40 molecule, TNF receptor superfamily member 5
genbank accession :
BC012419.1
immunogen :
Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
immunogen sequence protein sequence :
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETEC
LPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSE
TDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATG
VSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQ
AGTNKTDVVCGPQDRLR
protein accession :
AAH12419.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
50 ug
autodate :
2014-10-07
updatetime :
2014-10-30 16:06:07
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098