This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TNFSF8 monoclonal antibody (M09), clone 4E6
catalog :
H00000944-M09
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4E6
reactivity :
human
product information
catalog id :
H00000944-M09
product name :
TNFSF8 monoclonal antibody (M09), clone 4E6
product description :
Mouse monoclonal antibody raised against a partial recombinant TNFSF8.
clone name :
4E6
isotype :
IgG1 Kappa
gene name :
TNFSF8
gene alias :
CD153 CD30L CD30LG MGC138144
gene description :
tumor necrosis factor (ligand) superfamily, member 8
genbank accession :
BC093630.1
immunogen :
TNFSF8 (AAH93630.1, 63 a.a. ~ 234 a.a) partial recombinant protein.
immunogen sequence protein sequence :
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAY
LQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCES
GMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTST
FPLENVLSIFLYSNSD
LQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCES
GMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTST
FPLENVLSIFLYSNSD
protein accession :
AAH93630.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2015-08-10
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
