This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD80 monoclonal antibody (M01), clone 1G1
catalog :
H00000941-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G1
reactivity :
human
product information
catalog id :
H00000941-M01
product name :
CD80 monoclonal antibody (M01), clone 1G1
product description :
Mouse monoclonal antibody raised against a full length recombinant CD80.
clone name :
1G1
isotype :
IgG1 Kappa
gene name :
CD80
gene alias :
CD28LG CD28LG1 LAB7
gene description :
CD80 molecule
genbank accession :
BC042665
immunogen :
CD80 (AAH42665, 35 a.a. ~ 288 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMV
LTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEG
TYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFE
IPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVS
QDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTF
NWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFA
PRCRERRRNERLRRESVRPV
LTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEG
TYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFE
IPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVS
QDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTF
NWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFA
PRCRERRRNERLRRESVRPV
protein accession :
AAH42665
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,PLA-Ce
size :
100 ug
autodate :
2007-09-03
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
