This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
CD80 (Human) Recombinant Protein
catalog :
H00000941-H02
quantity :
25 ug
product information
catalog id :
H00000941-H02
product name :
CD80 (Human) Recombinant Protein
product description :
Purified CD80 (AAH11399.2, 137 a.a. - 230 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
gene name :
CD80
gene alias :
CD28LG CD28LG1 LAB7
gene description :
CD80 molecule
genbank accession :
NM_005191.2
immunogen sequence protein sequence :
SVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSW
LENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF
MCLIKYGHLRVNQTFN
LENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF
MCLIKYGHLRVNQTFN
protein accession :
AAH11399.2
form :
Liquid
concentration :
10 ug/ml
host cell :
Human HEK293T cells
preparation method :
Transfection of pSuper-CD80 plasmid into HEK293T cell, and the expressed protein was purified by Strep -Tactin affinity column.
storage buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
SDS-PAGE and Western Blot
tag :
His-Flag-StrepII
type clonality :
Protein
raised in host species :
Human
antigen species target species :
Human
application key :
PI,SDS-PAGE,ELISA,WB
size :
25 ug
autodate :
2/4/12
updatetime :
10/12/15 14:41
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
