This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD28 monoclonal antibody (M18), clone 4G11
catalog :
H00000940-M18
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4G11
reactivity :
human
product information
catalog id :
H00000940-M18
product name :
CD28 monoclonal antibody (M18), clone 4G11
product description :
Mouse monoclonal antibody raised against a partial recombinant CD28.
clone name :
4G11
isotype :
IgG1 Kappa
gene name :
CD28
gene alias :
MGC138290 Tp44
gene description :
CD28 molecule
genbank accession :
NM_006139.3
immunogen :
CD28 (NP_006130.1, 18 a.a. ~ 152 a.a) partial recombinant protein.
immunogen sequence protein sequence :
GNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLH
KGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESV
TFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIH
VKGKHLCPSPLFPGPSKP
KGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESV
TFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIH
VKGKHLCPSPLFPGPSKP
protein accession :
NP_006130.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA
size :
100 ug
autodate :
2015-08-10
updatetime :
2017-09-05 15:48:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
