This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CD9 DNAxPab
catalog :
H00000928-W02P
quantity :
100 ug
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00000928-W02P
product name :
CD9 DNAxPab
product description :
Rabbit polyclonal antibody raised against a partial-length human CD9 DNA using DNAx Immune technology.
gene name :
CD9
gene alias :
5H9 BA2 BTCC-1 DRAP-27 GIG2 MIC3 MRP-1 P24 TSPAN29
gene description :
CD9 molecule
genbank accession :
BC011988
immunogen :
CD9 (AAH11988, 112 a.a. ~ 195 a.a) partial-length human DNA
immunogen sequence protein sequence :
SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYAL
NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVF
DNKFHI
NCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVF
DNKFHI
protein accession :
AAH11988
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
Flow Cyt-Tr,IF-Ex,IF-Tr,WB-Tr
size :
100 ug
autodate :
5/29/20
updatetime :
4/22/21 10:53
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
