This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CCND2 monoclonal antibody (M01), clone 3B10
catalog :
H00000894-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00000894-M01
product name :
CCND2 monoclonal antibody (M01), clone 3B10
product description :
Mouse monoclonal antibody raised against a partial recombinant CCND2.
clone name :
3B10
isotype :
IgG1 kappa
gene name :
CCND2
gene alias :
KIAK0002 MGC102758
gene description :
cyclin D2
genbank accession :
BC010958
immunogen :
CCND2 (AAH10958, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDAL
TELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRD
GSKSEDELDQASTPTDVRDIDL
TELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRD
GSKSEDELDQASTPTDVRDIDL
protein accession :
AAH10958
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
