product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
CBS monoclonal antibody (M01), clone 3E1
catalog :
H00000875-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3.00E+01
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 27
Published Application/Species/Sample/DilutionReference
  • western blot; human; loading ...; fig 1d
Padmanabhan N, Kyon H, Boot A, Lim K, Srivastava S, Chen S, et al. Highly recurrent CBS epimutations in gastric cancer CpG island methylator phenotypes and inflammation. Genome Biol. 2021;22:167 pubmed publisher
  • western blot; mouse; loading ...; fig 8c
Nandi S, Mishra P. H2S and homocysteine control a novel feedback regulation of cystathionine beta synthase and cystathionine gamma lyase in cardiomyocytes. Sci Rep. 2017;7:3639 pubmed publisher
  • western blot; human; 1:7000
Ohmura M, Hishiki T, Yamamoto T, Nakanishi T, Kubo A, Tsuchihashi K, et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2015;46:102-13 pubmed publisher
  • western blot; rat; 1:5000
Miyamoto R, Otsuguro K, Yamaguchi S, Ito S. Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons. J Neurochem. 2014;130:29-40 pubmed publisher
Kar S, Shahshahan H, Hackfort B, Yadav S, Yadav R, Kambis T, et al. Exercise Training Promotes Cardiac Hydrogen Sulfide Biosynthesis and Mitigates Pyroptosis to Prevent High-Fat Diet-Induced Diabetic Cardiomyopathy. Antioxidants (Basel). 2019;8: pubmed publisher
Du C, Jin M, Hong Y, Li Q, Wang X, Xu J, et al. Downregulation of cystathionine ?-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type. Biochem Biophys Res Commun. 2014;451:239-45 pubmed publisher
Yamamoto T, Takano N, Ishiwata K, Ohmura M, Nagahata Y, Matsuura T, et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014;5:3480 pubmed publisher
Dufton N, Natividad J, Verdu E, Wallace J. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Sci Rep. 2012;2:499 pubmed publisher
Qipshidze N, Metreveli N, Mishra P, Lominadze D, Tyagi S. Hydrogen sulfide mitigates cardiac remodeling during myocardial infarction via improvement of angiogenesis. Int J Biol Sci. 2012;8:430-41 pubmed publisher
Ren Y, Wu S, Wang X, Yu F, Zhao J, Tang C, et al. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Chin Med J (Engl). 2011;124:3468-75 pubmed
Guo H, Gai J, Wang Y, Jin H, Du J, Jin J. Characterization of hydrogen sulfide and its synthases, cystathionine ?-synthase and cystathionine ?-lyase, in human prostatic tissue and cells. Urology. 2012;79:483.e1-5 pubmed publisher
Streeter E, Al Magableh M, Hart J, Badoer E. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Front Physiol. 2011;2:55 pubmed publisher
Roy A, Khan A, Islam M, Prieto M, Majid D. Interdependency of cystathione ?-lyase and cystathione ?-synthase in hydrogen sulfide-induced blood pressure regulation in rats. Am J Hypertens. 2012;25:74-81 pubmed publisher
Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya M. Placental markers of folate-related metabolism in preeclampsia. Reproduction. 2011;142:467-76 pubmed publisher
Kasparek M, Linden D, Farrugia G, Sarr M. Hydrogen sulfide modulates contractile function in rat jejunum. J Surg Res. 2012;175:234-42 pubmed publisher
Yamamoto T, Takano N, Ishiwata K, Suematsu M. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine ?-synthase. J Clin Biochem Nutr. 2011;48:96-100 pubmed publisher
Predmore B, Alendy M, Ahmed K, Leeuwenburgh C, Julian D. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Age (Dordr). 2010;32:467-81 pubmed publisher
Majtan T, Liu L, Carpenter J, Kraus J. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. J Biol Chem. 2010;285:15866-73 pubmed publisher
Li Q, Sun B, Wang X, Jin Z, Zhou Y, Dong L, et al. A crucial role for hydrogen sulfide in oxygen sensing via modulating large conductance calcium-activated potassium channels. Antioxid Redox Signal. 2010;12:1179-89 pubmed publisher
Hennig B, Diener M. Actions of hydrogen sulphide on ion transport across rat distal colon. Br J Pharmacol. 2009;158:1263-75 pubmed publisher
Xu G, Winston J, Shenoy M, Zhou S, Chen J, Pasricha P. The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Mol Pain. 2009;5:44 pubmed publisher
Lee M, Schwab C, Yu S, McGeer E, McGeer P. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Neurobiol Aging. 2009;30:1523-34 pubmed publisher
Martin G, McKnight G, Dicay M, Coffin C, Ferraz J, Wallace J. Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract. Dig Liver Dis. 2010;42:103-9 pubmed publisher
Wallace J, Vong L, McKnight W, Dicay M, Martin G. Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats. Gastroenterology. 2009;137:569-78, 578.e1 pubmed publisher
Majtan T, Singh L, Wang L, Kruger W, Kraus J. Active cystathionine beta-synthase can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. J Biol Chem. 2008;283:34588-95 pubmed publisher
Wallace J, Dicay M, McKnight W, Martin G. Hydrogen sulfide enhances ulcer healing in rats. FASEB J. 2007;21:4070-6 pubmed
Schicho R, Krueger D, Zeller F, Von Weyhern C, Frieling T, Kimura H, et al. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon. Gastroenterology. 2006;131:1542-52 pubmed
product information
catalog id :
H00000875-M01
product name :
CBS monoclonal antibody (M01), clone 3E1
product description :
Mouse monoclonal antibody raised against a partial recombinant CBS.
clone name :
3.00E+01
isotype :
IgG2a Kappa
gene name :
CBS
gene alias :
HIP4
gene description :
cystathionine-beta-synthase
genbank accession :
NM_000071
immunogen :
CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAK
EPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILP
DILKKIGDTPMVRINKIGKKFG
protein accession :
NP_000062
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
IP,S-ELISA,RNAi-Ab,ELISA,WB-Re,WB-Tr,WB-Ce,IHC-P
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098