This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CA1 monoclonal antibody (M07), clone 7G12
catalog :
H00000759-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
7G12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00000759-M07
product name :
CA1 monoclonal antibody (M07), clone 7G12
product description :
Mouse monoclonal antibody raised against a full length recombinant CA1.
clone name :
7G12
isotype :
IgG2a Kappa
gene name :
CA1
gene alias :
Car1
gene description :
carbonic anhydrase I
genbank accession :
BC027890
immunogen :
CA1 (AAH27890, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSET
KHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRS
VLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSA
ELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANP
KLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTY
PGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV
EGDNAVPMQHNNRPTQPLKGRTVRASF
KHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRS
VLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSA
ELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANP
KLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTY
PGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNV
EGDNAVPMQHNNRPTQPLKGRTVRASF
protein accession :
AAH27890
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,S-ELISA,ELISA,WB-Ti
size :
100 ug
autodate :
4/30/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
