This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
BLM monoclonal antibody (M01), clone 1E4
catalog :
H00000641-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1.00E+04
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00000641-M01
product name :
BLM monoclonal antibody (M01), clone 1E4
product description :
Mouse monoclonal antibody raised against a partial recombinant BLM.
clone name :
1.00E+04
isotype :
IgG1 Kappa
gene name :
BLM
gene alias :
BS MGC126616 MGC131618 MGC131620 RECQ2 RECQL2 RECQL3
gene description :
Bloom syndrome
genbank accession :
NM_000057
immunogen :
BLM (NP_000048, 1196 a.a. ~ 1295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SSVKKQKALVAKVSQREEMVKKCLGELTEVCKSLGKVFG
VHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEK
YGAEVISVLQKYSEWTSPAEDS
VHYFNIFNTVTLKKLAESLSSDPEVLLQIDGVTEDKLEK
YGAEVISVLQKYSEWTSPAEDS
protein accession :
NP_000048
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,ELISA,WB-Re
size :
100 ug
autodate :
10/12/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
